PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00026572-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 62aa    MW: 6890.04 Da    PI: 11.3251
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00026572-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.3e-291059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly+++s
  WALNUT_00026572-RA 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVVIFSSTGKLYDFAS 59
                        8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.483161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.18E-36260No hitNo description
SuperFamilySSF554552.62E-28260IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-29323IPR002100Transcription factor, MADS-box
PfamPF003196.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVVIFSS TGKLYDFAST  60
RS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D9e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A9e-19260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1447571e-50BT144757.1 Lotus japonicus clone JCVI-FLLj-15G19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018298.16e-36AGAMOUS-like 16
SwissprotA2RVQ56e-32AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A0D2R1C75e-37A0A0D2R1C7_G
STRINGVIT_03s0097g00160.t019e-35(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-33AGAMOUS-like 16